PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa15g014730.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 254aa    MW: 28913.2 Da    PI: 9.8704
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa15g014730.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B357.91.8e-1850142499
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                       +++++l+++ l lp+ f +++g+++++  +++l +e+g  W++  +  k +g++++++GW++F+ +n+L+++D++++kl++ +++++v+++++
  Csa15g014730.1  50 SRVTASNLRKDSLFLPRGFSRSNGLVNRK-CEIILLNEDGIPWKLIPS-HKPDGEVYIRNGWRSFCFENRLRVNDVLTLKLVE-TGTTPVLHLCS 141
                     5678999999***************9766.5**************994.34444599***********************998.88889***998 PP

                     S CS
              B3  99 k 99 
                     +
  Csa15g014730.1 142 S 142
                     6 PP

2B341.13.2e-13154246597
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS..SEE..EEEEE CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr..sefelvvkvf 97 
                     +++++++k+  l+lp +f++++g+++++  ++tl d+ g + +  l+ + k g++ l+k W+eF++ ng++ g+++ ++l+++  ++++ ++k++
  Csa15g014730.1 154 TLRPYNFKKYKLCLPGTFVKANGIENAR--KITLVDRYGIRRTTSLKPDDKHGKMRLGKEWREFCDVNGVNIGESFKLELIKErkDTANHLLKFC 246
                     568999****************988555..8********888888877999999*************************9955344555555555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.9E-1940142IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.34E-2041142IPR015300DNA-binding pseudobarrel domain
CDDcd100171.28E-1747141No hitNo description
SMARTSM010193.6E-2447143IPR003340B3 DNA binding domain
PROSITE profilePS5086312.85847142IPR003340B3 DNA binding domain
PfamPF023623.3E-1749142IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.3E-14143247IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.63E-14146244IPR015300DNA-binding pseudobarrel domain
CDDcd100175.36E-11149234No hitNo description
PROSITE profilePS508639.996150248IPR003340B3 DNA binding domain
SMARTSM010193.8E-12150249IPR003340B3 DNA binding domain
PfamPF023627.9E-12152247IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MYTLVKLNCN TKILFKFSSK VETDSDSDSE KNQNTADEGS SSDHHSCFVS RVTASNLRKD  60
SLFLPRGFSR SNGLVNRKCE IILLNEDGIP WKLIPSHKPD GEVYIRNGWR SFCFENRLRV  120
NDVLTLKLVE TGTTPVLHLC SSSTTSQCRL LTLTLRPYNF KKYKLCLPGT FVKANGIENA  180
RKITLVDRYG IRRTTSLKPD DKHGKMRLGK EWREFCDVNG VNIGESFKLE LIKERKDTAN  240
HLLKFCSKVL NFP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010488930.11e-150PREDICTED: B3 domain-containing protein REM10-like
TrEMBLD7L9U11e-111D7L9U1_ARALL; Putative uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_30009201e-110(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20422261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.13e-40B3 family protein